AI & ChatGPT searches , social queries for LL
What is the meaning of LL. Phrases containing LL
See meanings and uses of LL!
What is the meaning of LL. Phrases containing LL
See meanings and uses of LL!LL
Digraph
Ll or ll is a digraph that occurs in several languages. In English, ⟨ll⟩ often represents the same sound as single ⟨l⟩: /l/. The doubling is used to indicate
Ll
Topics referred to by the same term
Appendix:Variations of "ll" in Wiktionary, the free dictionary. LL may refer to: Ll or ll, a digraph that occurs in several natural languages 'll, meaning will
LL
American retail company
L.L.Bean is an American privately held retail company that was founded in 1912 by Leon Leonwood Bean. The company, headquartered in Freeport, Maine (where
L.L.Bean
American rapper (born 1968)
James Todd Smith (born January 14, 1968), known professionally as LL Cool J (short for Ladies Love Cool James), is an American rapper and actor. He is
LL_Cool_J
Top-down parser that parses input from left to right
parser types are LL(*) and LL(finite). A parser is called LL(*)/LL(finite) if it uses the LL(*)/LL(finite) parsing strategy. LL(*) and LL(finite) parsers
LL_parser
Doctorate in legal studies
A Doctor of Laws (LL.D.) is a doctoral degree in legal studies. The abbreviation LL.D. stands for Legum Doctor, with the double "L" in the abbreviation
Doctor_of_Laws
Type of postgraduate qualification
A Master of Laws (M.L. or LL.M.; Latin: Magister Legum or Legum Magister) is a postgraduate academic degree, pursued by those either holding an undergraduate
Master_of_Laws
Motor vehicle
LCD (WiLL PC) WiLL Alkaline ion water conditioner (WiLL A-Pure PJ-A301) WiLL Air purifier (WiLL Ion Conditioner) WiLL Microwave (WiLL Range) WiLL Full automatic
WiLL
Type of a context-free grammar
In formal language theory, an LL grammar is a context-free grammar that can be parsed by an LL parser, which parses the input from Left to right, and constructs
LL_grammar
Type of undergraduate qualification
in those institutions. "LLB" stands for Legum Baccalaureus in Latin. The "LL." of the abbreviation for the degree is from the genitive plural legum ("of
Bachelor_of_Laws
2024 studio album by The Hellp
LL is the second studio album and major-label debut by American band the Hellp. It was released on October 25, 2024, through Atlantic Records under the
LL_(album)
Elite Finnish ringette and ice hockey club
Lapinlahden Luistin -89 (abbr. LL-89) in Lapinlahden, from the municipality Pohjois-Savosta, is a home club specializing in ice sports, whose sports include
LL_-89
Tumblr blog
Your LL Bean Boyfriend is a Tumblr blog showing models from the L.L. Bean catalog with romantic captions. It was started as a joke but has spawned a companion
Your_LL_Bean_Boyfriend
Group of chondrites with low iron and low metal content
The LL chondrites are a group of stony meteorites, the least abundant group of the ordinary chondrites, accounting for about 10–11% of observed ordinary-chondrite
LL_chondrite
This is the discography of American rapper LL Cool J. Action Bronson - "Strictly 4 My Jeeps (remix)" (w/ Lloyd Banks) (Album: n/a) Alicia Keys - "Teenage
LL_Cool_J_discography
Variable star in the constellation Pegasus
LL Pegasi (AFGL 3068) is a Mira variable star surrounded by a pinwheel-shaped nebula, IRAS 23166+1655, thought to be a preplanetary nebula. It is a binary
LL_Pegasi
The LL-100 panel is a group of 100 human leukemia and lymphoma cell line, can be used in model of biomedical research. LL-100 panel cell lines cover the
LL-100_panel
American police procedural television series
premiere on October 6, 2026 on CBS. A spin-off of NCIS, the series will feature LL Cool J reprising his character of Sam Hanna from NCIS: Los Angeles, leading
NCIS:_New_York
Postcode area within the United Kingdom
Template:Attached KML/LL postcode area KML is from Wikidata The LL postcode area, also known as the Llandudno postcode area, is a group of 67 postcode
LL_postcode_area
Polish artist (1937–2022)
Diploma of the Association of Polish Art Photographers [pl] (ZPAF). Natalia LL was a conceptual artist and photographer, associated with the avant-garde
Natalia_LL
Painting by James Tissot
Portrait of Mademoiselle L.L. (French: Portrait de Mademoiselle L.L.) is an 1864 oil painting by the French artist James Tissot. It depicts a young woman
Portrait_of_Mademoiselle_L.L.
Numerical method for differential equations
In numerical analysis, the local linearization (LL) method is a general strategy for designing numerical integrators for differential equations based on
Local_linearization_method
American band
followed by numerous extended plays and singles. In 2024, their sophomore album LL was released on Atlantic Records. Their third album Riviera was released in
The_Hellp
2023 Indian Bengali TV series
Geeta LL.B. is an Indian Bengali language romantic thriller courtroom drama television series that premiered on 20 November 2023 and ended abruptly on
Geeta_LL.B
1971 studio album by Cowboy
5'll Getcha Ten is the second studio album by American rock band Cowboy. Produced by Johnny Sandlin, the album was released in October 1971 by Capricorn
5'll_Getcha_Ten
Japanese automobile platform
The Nissan LL platform is a rear-wheel drive and all-wheel drive automobile platform made by Nissan.[when?] Vehicles built on this platform share floor
Nissan_LL_platform
Handheld game console
consoles Japanese: ニンテンドーDSi, Hepburn: Nintendō Dī Esu Ai Japanese: ニンテンドーDSi LL, Hepburn: Nintendō Dī Esu Ai Eru Eru 170,779 units were sold according to
Nintendo_DSi
Specialized Master of Laws degree
Master of European Law (LL.M. Eur) is a specialized Master of Laws (LL.M.) degree, awarded after successful completion of a course of study in the law
Master_of_European_Law
Latin letter L with dot below
In Asturian, a digraph (Ḷḷ, lower case: ḷḷ) is used to represent some western dialectal phonemes corresponding to standard ll (representing a palatal
Ḷ
Letter of the Latin alphabet
Ł (minuscule: ł), known as L with stroke, is a Latin-script letter. It is used in the Polish, Kashubian, Sorbian, Silesian, Belarusian Latin, Ukrainian
Ł
1997 studio album by LL Cool J
Phenomenon is the seventh studio album by rapper LL Cool J, released on October 14, 1997, through Def Jam Recordings. After the success of his previous
Phenomenon_(LL_Cool_J_album)
Family of a Maldivian Monarch
The Family of Iskander ll was a Maldivian family. It is the family of Iskander ll of the Maldives and his ancestors. The family is an origin Family of
Family of Iskander II of the Maldives
Family_of_Iskander_II_of_the_Maldives
18th century Sultan of the Maldives
Sultan Ibrahim Iskander ll (Arabic: إبراهيم إسكندر الثاني; Dhivehi: އިބްރާހީމް އިސްކަންދަރު ދެވަނަ އެވެ) was the sultan of the Maldives from 1721–1750
Ibrahim_Iskander_II
1985 studio album by LL Cool J
Radio is the debut studio album by American rapper LL Cool J, released on November 18, 1985, by Def Jam Recordings and Columbia Records. It was also Def
Radio_(LL_Cool_J_album)
Currency of Lebanon
Lebanese Civil War, USD1 was worth: LL 3.07 in 1965 LL 3.26 in 1970 LL 3 in 1971 LL 2.70 in 1973 LL 2.25 in 1975 about LL 4 in 1981 In 1986, the pound began
Lebanese_pound
New Zealand-born Canadian-based law academic
the Fragile Path of Progress (Edward Elgar, June 2008). LL.B. (Canterbury, New Zealand), 1961, LL.M. (Adelaide) 1962, called to the Bar of New Zealand in
Michael_Trebilcock
the chemical reaction N-succinyl-LL-2,6-diaminoheptanedioate + H2O ⇌ {\displaystyle \rightleftharpoons } succinate + LL-2,6-diaminoheptanedioate Thus, the
Succinyl-diaminopimelate desuccinylase
Succinyl-diaminopimelate_desuccinylase
Binary star in the constellation Aquarius
LL Aquarii is an eclipsing binary star system in the equatorial constellation of Aquarius, abbreviated LL Aqr. At peak brightness it has a combined apparent
LL_Aquarii
Top-down parser utilizing recursion
require backtracking. Predictive parsing is possible only for the class of LL(k) grammars, which are the context-free grammars for which there exists some
Recursive_descent_parser
Third EP by South Korean indie rock band Jannabi
ll : Grippin'TheGreen (Korean: 잔나비 소곡집 ll : 초록을거머쥔우리는; RR: Jannabi Sogogjib ll : Cholog-eulgeomeojwin-ulineun, stylized as Jannabi's small pieces ll :
Jannabi's Small Pieces II: Grippin'TheGreen
Jannabi's_Small_Pieces_II:_Grippin'TheGreen
2003 film directed by Gary Hardwick
is a 2003 American romantic comedy film starring LL Cool J and Gabrielle Union, revolving around LL's character, Ray Adams, being paid to date a troublesome
Deliver_Us_from_Eva
1989 single by LL Cool J
single from LL Cool J's third album, Walking with a Panther. It was released in 1989 by Def Jam Recordings and was produced by Dwayne Simon and LL Cool J.
Big_Ole_Butt
2000 studio album by LL Cool J
(simply known as G.O.A.T.) is the eighth studio album by American rapper LL Cool J. Released September 12, 2000, on the Def Jam label, the album topped
G.O.A.T._(LL_Cool_J_album)
Classification of soils for road-construction purposes
A-7-5 subgroup is equal to or less than the LL - 30. Plasticity index of A-7-6 subgroup is greater than LL - 30. Hogentogler, C.A.; Terzaghi, K. (May 1929)
AASHTO Soil Classification System
AASHTO_Soil_Classification_System
1996 single by LL Cool J
"Doin It" is a song by American rapper LL Cool J, released by Def Jam Recordings on February 20, 1996, as the second single from his sixth album, Mr. Smith
Doin'_It_(LL_Cool_J_song)
Law college in Punjab, India
Amritsar in the Indian state of Punjab. It offers 5 year Integrated B.A. LL.B., B.Com LL.B. and 3 years law courses approved by Bar Council of India (BCI),
Khalsa_College_of_Law
catalyzes the chemical reaction N-acetyl-LL-2,6-diaminoheptanedioate + H2O ⇌ {\displaystyle \rightleftharpoons } acetate + LL-2,6-diaminoheptanedioate Thus, the
N-acetyldiaminopimelate deacetylase
N-acetyldiaminopimelate_deacetylase
1983 single by Rufus and Chaka Khan
Search Results – LL Cool J". Irish Singles Chart. Retrieved August 1, 2023. "Nederlandse Top 40 – LL Cool J" (in Dutch). Dutch Top 40. "LL Cool J – Ain't
Ain't_Nobody
Law University in Cuttack, Odisha
Colony in Cuttack in Odisha. It offers 3 years LL.B.(Hons.), 5 years Integrated B.A., LL.B.(Hons) and 2 years LL.M. course approved from Bar Council of India
Madhusudan_Law_University
Rapid transit service
the Brooklyn–Manhattan Transit Corporation's 16 service. The 16 became the LL in 1967 and then the L in 1985. In the early 2000s, the L saw a dramatic increase
L (New York City Subway service)
L_(New_York_City_Subway_service)
2002 single by LL Cool J featuring Amerie
American rapper LL Cool J featuring American singer Amerie. The song was released on December 14, 2002, as the second single from LL Cool J's ninth studio
Paradise_(LL_Cool_J_song)
Law college in Andhra Pradesh
Indian state of Andhra Pradesh. The college offers 3 years LL.B. and five-years integrated LL.B. courses approved by the Bar Council of India (BCI), New
Sri Venkateswara College of Law
Sri_Venkateswara_College_of_Law
Law college in Dehradun, India
and offers a five-year integrated Bachelor of Law (B.A./B.B.A.LL.B) degree, a three-year (LL.B) degree, and a one-year Master of Law (LLM) degree. The college
Siddhartha Law College, Dehradun
Siddhartha_Law_College,_Dehradun
American sitcom
In the House is an American sitcom television series starring LL Cool J, Debbie Allen, Maia Campbell, Jeffery Wood, Alfonso Ribeiro and Kim Wayans. The
In_the_House_(TV_series)
2016 studio album by All Tvvins
llVV ("All Tvvins"; the first two characters are lower-case L's) is the debut album by Irish electronic rock band All Tvvins. It was released through Warner
LlVV
2025 referendum
Colorado Proposition LL, officially the Allow State to Retain Revenue From Proposition FF Measure, is a legislatively referred state statute that appeared
2025_Colorado_Proposition_LL
2002 studio album by LL Cool J
studio album by American rapper LL Cool J. It was released by Def Jam Recordings on October 15, 2002, in the United States. LL Cool J and 10 hit a milestone
10_(LL_Cool_J_album)
Biochemical enzyme catalyst
class is LL-2,6-diaminoheptanedioate:2-oxoglutarate aminotransferase. Other names in common use include LL-diaminopimelate transaminase, LL-DAP aminotransferase
L,L-diaminopimelate aminotransferase
L,L-diaminopimelate_aminotransferase
French for LL.B. and most LL.M. programs, with the J.D. and LL.D. program being bilingual French-English and some programs (such as the LL.M. in Business
Université de Montréal Faculty of Law
Université_de_Montréal_Faculty_of_Law
Children's baseball tournament
with the most championships (8); the Whalley LL of Surrey, British Columbia has seven; and Glace Bay LL and Trail are third with five. The Prairie Provinces
Little League World Series in Canada
Little_League_World_Series_in_Canada
2024 studio album by LL Cool J
rapper and actor LL Cool J, released on September 6, 2024, by LL Cool J, Inc., Def Jam Recordings, and Virgin Music Group. It is LL Cool J's first official
The_FORCE
Poem by E. E. Cummings
l(a le af fa ll s) one l iness — E. E. Cummings "l(a" is a poem by E. E. Cummings. It is the first poem in his 1958 collection 95 Poems. "l(a" is arranged
L(a
Canadian lawyer, academic and author (born 1932)
He received a BComm. (1955), LL.B. (1958), and honorary LL.D. from the University of Toronto, and a PhD (1968) and LL.D from Cambridge University. He
Martin_Friedland
Typographical symbol
This page uses IPA notation for orthographic or other linguistic analysis. For the meaning of how ⟨ ⟩, | |, / /, and [ ] are used here, see this page.
Middle_dot
1791 biography of Samuel Johnson by James Boswell
The Life of Samuel Johnson, LL.D. by James Boswell is a 1791 biography of English writer and literary critic Samuel Johnson. The work was from the beginning
Life_of_Samuel_Johnson
1999 film by Renny Harlin
stars Thomas Jane, Saffron Burrows, Samuel L. Jackson, Michael Rapaport and LL Cool J. The film follows a team of scientists in an isolated underwater facility
Deep_Blue_Sea_(1999_film)
Handheld game console
Newニンテンドー3DS, Hepburn: Nyū Nintendō Surī Dī Esu Called the New Nintendo 3DS LL (Newニンテンドー3DS LL) in Japan "New Nintendo 3DS to be released in South Korea". Bulbanews
New_Nintendo_3DS
English priest, Canon of Windsor (d. 1522)
John Oxenbridge LL.D. (died 25 July 1522) was a Canon of Windsor from 1509 to 1522. He was the son of Robert Oxenbridge and Anne Lyvelode. He was educated
John_Oxenbridge_(priest)
1999 single by LL Cool J
"Say What" is a single by LL Cool J from the hip-hop compilation, Violator: The Album. It was released on August 3, 1999 for Violator Records and Def Jam
Say_What_(LL_Cool_J_song)
1991 film by Kevin Hooks
on the Top R&B Albums chart, and its lone single, "Strictly Business" by LL Cool J, did not chart. On its first weekend the film made $2.4 million and
Strictly_Business_(1991_film)
Law college in Odisha
Dhenkanal in the Indian state of Odisha. It offers 3 years LL.B. and 2 years Master of Laws (LL.M) courses approved by the Bar Council of India (BCI) and
Dhenkanal_Law_College
American actress and fashion designer
Sunday. Jones dated rapper and actor LL Cool J from 1992 to 1994. In his autobiography, I Make My Own Rules, LL Cool J stated that he ended their relationship
Kidada_Jones
1990 studio album by LL Cool J
Mama Said Knock You Out is the fourth studio album by American rapper LL Cool J. It was produced mostly by Marley Marl and recorded at his "House of Hits"
Mama_Said_Knock_You_Out
qualify to practice as either a barrister or a solicitor in Hong Kong. The "LL." of the abbreviation for the certificate is from the genitive plural legum
Postgraduate Certificate in Laws
Postgraduate_Certificate_in_Laws
1989 studio album by LL Cool J
a Panther is the third studio album by American hip hop recording artist LL Cool J, released June 9, 1989, on Def Jam Recordings. While his previous album
Walking_with_a_Panther
Protein family
reaction LL-2,6-diaminoheptanedioate ⇌ {\displaystyle \rightleftharpoons } meso-diaminoheptanedioate Hence, this enzyme has one substrate, LL-2,6-diaminoheptanedioate
Diaminopimelate_epimerase
Hardwood flooring retailer
its name to LL Flooring. The corporate entity name was changed to LL Flooring Holdings, Inc. effective January 1, 2022. In July 2024, LL Flooring warned
Lumber_Liquidators
Law college in Assam
state of Assam. It offers 3 years law courses, 5 Year Integrated B.A. LL.B.and LL.B. courses affiliated to Dibrugarh University. This College is recognised
Jorhat_Law_College
List of law schools in Haryana, India
One can pursue his or her study in various law courses such as LL.B, integrated LL.B, LL.M and doctoral courses. LLB is an undergraduate degree that covers
List of law schools in Haryana
List_of_law_schools_in_Haryana
courses - LL.B. (3 years), B.A. LL.B (5 years), B. Ed. JCL is one of the first law colleges to offer the integrated degree course of B.A. LL.B. and LL.B. (3
Janhit_College_of_Law
program resulting in a Bachelor of Law (LL.B.) or a postgraduate degree resulting in a Masters of Law (LL.M.). Some LL.M. programs in Taiwan are offered to
List_of_law_schools_in_Taiwan
2003 film directed by Clark Johnson
Jim McClain. It stars Samuel L. Jackson, Colin Farrell, Michelle Rodriguez, LL Cool J, Josh Charles, Jeremy Renner, Brian Van Holt and Olivier Martinez with
S.W.A.T._(2003_film)
Law college in Kerala
are selected through a state level entrance test. The college offers LL.B and LL.M courses. The city has a court complex that is more than two centuries
Government Law College, Kozhikode
Government_Law_College,_Kozhikode
1987 single by LL Cool J
"I'm Bad" (sometimes written as I'm BAD) is the first single from LL Cool J's second album, Bigger and Deffer. It was released in 1987 for Def Jam Recordings
I'm_Bad
1990 single by Sonic Youth
Gordon conducted with LL Cool J for Spin. Although he is never mentioned by name, the song's lyrics contain several references to LL Cool J. Gordon's lyrics
Kool_Thing
Irish historian, antiquary and topographer
Edward Ledwich LL.D. F.S.A. (1738 – 8 August 1823) was an Irish historian, antiquary and topographer. Ledwich was born in Dublin, the son of John Ledwich
Edward_Ledwich
Law college in Gujarat
(BCI), New Delhi. It offers three years undergraduate course (LL.B. or Bachelor of Law) and LL.M. degree in legal education affiliated to the Gujarat University
L.A._Shah_Law_College
Dwarf galaxy in the local group
Aquarius ll (also Aquarius 2, AQU 2 or Aqu ll) is a mildly elliptical dwarf satellite galaxy to the Milky Way located around 110 kiloparsecs[contradictory]
Aquarius_II
Scottish soldier, compiler and miscellaneous writer
Robert Beatson, LL.D. FRSE FSA (1741–1818) was a Scottish compiler and miscellaneous writer. He was born on 25 June 1741 at Dysart in Fife, Scotland, the
Robert_Beatson
Terminal research doctoral degree in law
can be earned, higher than the Master of Laws (LL.M.), Juris Doctor (J.D.), and Bachelor of Laws (LL.B.). The SJD is offered by the Australian National
Doctor_of_Juridical_Science
French printer
Asia, Africa and the Americas. The trade mark of the enterprise was ″L.L." ("LL"). The firm was one of the most important postcard editors in France.
Léon_&_Lévy
Federal service academy
Laws (LL.M.) degree in Military Law. The center educates military, civilian, and international personnel in legal and leadership skills. The LL.M. curriculum
The Judge Advocate General's Legal Center and School
The_Judge_Advocate_General's_Legal_Center_and_School
CPU instructions which read and modify an unaltered value in memory
In computer science, load-linked/store-conditional (LL/SC), sometimes known as load-reserved/store-conditional (LR/SC), are a pair of instructions used
Load-link/store-conditional
Chemical enriched dwarf galaxy
Grus ll is an ultra-faint dwarf galaxy (UFD) located at a distance of 55 kiloparsecs from the Milky Way in the constellation of Grus. It has a higher than
Grus_II
2008 single by LL Cool J featuring Lil' Mo
"Cry" is a single by LL Cool J from his twelfth studio album, Exit 13 (2008). The song features guest vocals by R&B singer Lil' Mo and production by Andreas
Cry_(LL_Cool_J_song)
American businessman and educator (1853–1925)
ISBN 9780810832879 L.L. Nunn timeline from Fort Lewis College Foundation, Center of Southwest Studies L.L. Nunn papers from Cornell University L.L. Nunn page
L._L._Nunn
1997 single by LL Cool J
"Phenomenon" is the a song by American rapper LL Cool J, released as the lead single from his seventh studio album, Phenomenon (1997). It samples the Creative
Phenomenon_(LL_Cool_J_song)
2024 studio album by Lamin
SkyLL is the third solo studio album by Danish rapper and songwriter Lamin. It was released by Force Majeure Records, under the Universal Music Denmark
SkyLL
Degree in law
English law, occupying a similar position as the Master of Laws (M.L. or LL.M.; Latin: Magister Legum or Legum Magister) programmes of other British universities
Bachelor_of_Civil_Law
Group of antimicrobial peptides in vertebrates
antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa]
Cathelicidin antimicrobial peptide
Cathelicidin_antimicrobial_peptide
Slangs & AI meanings
Looks Like Trouble
Laughing Like A Bitch.
marijuana
Lots and Lots of Thunderous Applause
Laugh Like F**k or Laughing Like F**k.
Lloyds list is London rhyming slang for drunk, intoxicated (pissed).
it’ll be alright ‘She’ll be apples, mate: also ‘she’s apps’
Long-haired, 'leather man load'.
Livin' Large
Harold Lloyd is British slang for to slip a lock using a trip of celluloid or plastic.
Like Leno on Meth
I’ll fill you in (courtesy of Jim Hip)
Amazing or awesome.
Live Long and Prosper
LL
Slangs & AI derived meanings
Noun. The drug LSD. Lysergic acid diethylamide. [Orig. U.S. 1960s]
Unsteady
Heroin
Curry. I'm going for a ruby. Ruby Murray was a singer in Glasgow back in the 30's or 40's - thanks to Peter Cotterell for the Ruby Murray info. N. Matthews tells me that Ruby was an Irish singer (1935-1996) popular in the mid to late 1950's. Got a note from Sandy Everitt who knew Ruby Murray 6 Ruby was a top recording star in the 1950's who achieved the rare feat of having five songs in the top 20 at one time. Ruby died in 1996
The touching and playing with the genitals. [He missed first base and started at third.].
Glass of milk
Sticky bun is London Cockney rhyming slang for a son.
Phrs. Beginning a phrase will mean 'there's no way', such as "bugger if I'm going to volunteer when it'll mean missing the party". It is an abbreviated form of 'I'll be buggered if...'.
Thelma Ritter is London Cockney rhyming slang for a lavatory (shitter). Thelma Ritter is London Cockney rhyming slang for the anus (shitter).
LL
LL
LL
LL
LL
n.
A South American mammal (Auchenia vicunna) native of the elevated plains of the Andes, allied to the llama but smaller. It has a thick coat of very fine reddish brown wool, and long, pendent white hair on the breast and belly. It is hunted for its wool and flesh.
n.
One half of the axis of an /llipse or other figure.
n.
A part of the Royal Exchange, in London, appropriated to the use of underwriters and insurance brokers; -- called also Lloyd's Rooms.
n.
The llama.
n.
An extensive plain with or without vegetation.
superl.
Made, as a vowel, with a less tense, and more open and relaxed, condition of the mouth organs; -- opposed to primary as used by Mr. Bell, and to narrow as used by Mr. Sweet. The effect, as explained by Mr. Bell, is due to the relaxation or tension of the pharynx; as explained by Mr. Sweet and others, it is due to the action of the tongue. The wide of / (/ve) is / (/ll); of a (ate) is / (/nd), etc. See Guide to Pronunciation, / 13-15.
n.
One of the inhabitants of the llanos of South America.
superl.
Made with a somewhat elevated position of some certain part of the tongue, in relation to the palate; midway between the high and the low; -- said of certain vowel sounds; as, a (ale), / (/ll), / (/ld). See Guide to Pronunciation, // 10, 11.
n.
A large ruminant used in Asia and Africa for carrying burdens and for riding. The camel is remarkable for its ability to go a long time without drinking. Its hoofs are small, and situated at the extremities of the toes, and the weight of the animal rests on the callous. The dromedary (Camelus dromedarius) has one bunch on the back, while the Bactrian camel (C. Bactrianus) has two. The llama, alpaca, and vicua, of South America, belong to a related genus (Auchenia).
n.
An association of underwriters and others in London, for the collection and diffusion of marine intelligence, the insurance, classification, registration, and certifying of vessels, and the transaction of business of various kinds connected with shipping.
pl.
of Llano
n.
See Karyoplasma. L () L is the twelfth letter of the English alphabet, and a vocal consonant. It is usually called a semivowel or liquid. Its form and value are from the Greek, through the Latin, the form of the Greek letter being from the Phoenician, and the ultimate origin prob. Egyptian. Etymologically, it is most closely related to r and u; as in pilgrim, peregrine, couch (fr. collocare), aubura (fr. LL. alburnus).
n.
An extinct genus of herbivorous Tertiary mammals, once supposed to have resembled the tapir in form, but now known to have had a more slender form, with a long neck like that of a llama.
a.
Applied to certain consonants having a "liquid" or softened sound; e.g., in French, l or ll and gn (like the lli in million and ni in minion); in Italian, gl and gn; in Spanish, ll and ; in Portuguese, lh and nh.
n.
See Llama.
n.
One of the adherents of Charles L. or Charles LL.; -- so called by the opposite party.
n.
A defect in pronunciation of the letter l when doubled, which consists in giving it a sound as if followed by y, similar to that of the letters lli in billion.
n.
A South American ruminant (Auchenia llama), allied to the camels, but much smaller and without a hump. It is supposed to be a domesticated variety of the guanaco. It was formerly much used as a beast of burden in the Andes.
LL
LL
LL